PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08191.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 164aa    MW: 17875.7 Da    PI: 10.0435
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08191.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS111.98.7e-357163225374
       GRAS 225 devLklvkslsPkvvvvveqeadhnse......sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae..rrerhetlekWr 316
                  +L  v+++sP vvv+v+ e   +++      sF + f+  le+ys++++sl+a +   se+ +k+E+++l+++iv +v ++ a+   +   ++ ++ r
  PK08191.1   7 GGFLGEVRRVSPAVVVFVDGEGWGGEPgtapttSFRRNFVGGLEFYSMVLESLDAAM-VGSEWVRKIEAFVLKPRIVMAVEAASAAaaAVGSGRRTASFR 105
                569******************655444444566********************8885.799*******************9887763366788999**** PP

       GRAS 317 erleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                e+++ aG++pv+ls +a  qa++ll kv+++g++v +++++lvl+W++r+Lv++S+Wr
  PK08191.1 106 EMFHGAGMRPVQLSRFADFQAECLLGKVQVRGFHVAKRQAELVLCWHERALVATSVWR 163
                *********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.5161143IPR005202Transcription factor GRAS
PfamPF035143.0E-327163IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
VLRHHGGGFL GEVRRVSPAV VVFVDGEGWG GEPGTAPTTS FRRNFVGGLE FYSMVLESLD  60
AAMVGSEWVR KIEAFVLKPR IVMAVEAASA AAAAVGSGRR TASFREMFHG AGMRPVQLSR  120
FADFQAECLL GKVQVRGFHV AKRQAELVLC WHERALVATS VWRC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099836.12e-73hypothetical protein L484_009050
SwissprotO232101e-55SCL15_ARATH; Scarecrow-like protein 15
TrEMBLW9RB662e-73W9RB66_9R
STRINGGLYMA02G06530.14e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59593252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.14e-45GRAS family protein